A budget-friendly option that requires minimal maintenance, sand filters are ideal for in-ground or above-ground pools. The above item details were provided by the Target Plus Partner. They are under the liner and can be seen and felt, but I never noticed them with the old liner.). Our main number is (706) 863-1207. Thank you Steph & Pete, Super helpful staff! The recommended dosage is 1 Tablet per week for every 10,000 gallons of pool water.
Appreciate that they have found cheaper alternative solutions when I came in asking for more expensive ones and have saved me $100s by giving me free advice to try before buying new products from them. Pool filters are made from various materials that can filter out these micro contaminants, choosing which one is the best for your pool comes down to price, pool size, required maintenance and overall cost of clarity. Skim filters are easy to operate . On occasion, manufacturers may modify their items and update their labels. Before the sale she did educate us on the various options for sanitizing our pool and balancing it. They will be hired to do the next one. They have answered the many questions I had with patience. Including staying late 15 minutes on a Friday afternoon for me to get some chemicals!!
17.5 L skimmer with cartridge system integrated. 3 Jumbo Tablets Green Out Shock- 1 lb Bags Strongest shock on the market Built in algaecide For super-chlorinating pool water 7 day chlorine residual pH Neutral 5 year shelf life Available in Hayward EC40 DE Filter Perflex Extended-Cycle diatomaceous earth (DE) filters provide crystal clear, sparkling water at an economical price. App Store is a service mark of Apple Inc. Google Play is trademark of Google, Inc. All other trademarks referenced herein are the property of their respective owners. ), is really the only difference. Pete Alewine sells and services two types of pool filters: sand filters and cartridge filters. The only pool company that would come out and look at issues with pool. All Rights Reserved. We are now enjoying our pool year round! I am so glad I chose Pete Alwine. He did this without ever making me feel pressured to purchase. These replacement filter cartridges filter out debris, dirt, and other contaminants thanks to ultra-fine, heavy-duty paper with more pleats than your average pool filter cartridge. Products shown as available are normally stocked but inventory levels cannot be guaranteed, For screen reader problems with this website, please call 1-800-430-3376 or text 38698 (standard carrier rates apply to texts), It's easy to overlook, but even your vacuum needs a good cleaning now and then, Happy Tab - Holds TWO 3 in. This means that every time you visit this website you will need to enable or disable cookies again. Country*COUNTRY*AUSTRALIAAUSTRIABELGIUMBRAZILBULGARIACANADACHILECHINACOLOMBIACROATIACYPRUSCZECH REPUBLICDENMARKEGYPTFRANCEGERMANYGREECEHONG KONGHUNGARYINDIAINDONESIAITALYKAZAHSTANMALAYSIAMEXICOMONTENEGROMOROCCONETHERLANDSNEW ZEALANDPOLANDPORTUGALROMANIARUSSIASERBIASINGAPORESOUTH AFRICASPAINSWEEDENSWITZERLANDTHAILANDTUNISIATURKEYUAEUNITED KINGDOMUSAVIETNAMOTHER COUNTRIES, Subject *Extra product informationComplete catalog.
That is the job of the chemicals circulated through the pool. As they say, "There's an App! The measurement used is known as micrometer (micron for short), which is just one millionth of a meter. Awesome people and great and honest service. We had a miscommunication with pool service and when I brought it to their attention, they resolved the issue immediately. I just wanted to give a shout out to Pete Alewine's Pool and Spa (PAP&S) with particular attention to their crew. The filter is one part of the circulatory system of the pool. Your pool's filter has an important job - to keep your pool clean. Multi-port Valves are constructed of molded ABS material with durable plastic handles. I needed a new pump for my plug-n-play Marquis spa. Give us a call Monday through Saturday. As I was not the original purchaser they were unwilling to help. Would highly recommend them and would give more stars if possible. 2017 Expertos en Piscinas y Spas AstralPool. We now have an 2" Camlock inlet for high speed filling and a separate outlet down stream for draining, all controlled by the Jandy Valve located under the house, with flood vents just in case.Nick, another spa technician came out and educated us on pool operation and initial setup. We recommend that you do not rely solely on the information presented. Kelvin was great and Knowledgeable about helping me with a Hot Tub I inherited. Chlorine Tabs.
Very nice people, there helped me with everything I needed. (Only thing was I wish they had told me to go pick up the bigger rocks on the ground before installing the new liner. The diatoms act just like a sponge water can pass through, but microscopic impurities like dirt, algae, and some forms of bacteria can't. Units will give you years of trouble free cleaning. All sand filters have an installed pressure gauge. filter sand ground above sandman wave system inch pump pools pool swimming filters gallon 1hp hp Island Recreational. All Rights Reserved. To this regard, any users who do not wish to be segmented should refrain from signing up for the newsletter.Your data shall not be assigned, sold, leased or in any other way whatsoever made available to third parties. Glad this place opened up close. All Aqua-line filters come with a new filter cartridge. 2000-2022 Home Depot. They got it done earlier than expected and the best thing about it was it was 100% stress free for me! They are available in two models: top and side mount. He helped me design a system that allowed us to install 2" PVC pipes with a 3-way Jandy Valve from the high speed drain. He did a great job and didnt have to spend all day on it. 2141 Babcock Blvd Pittsburgh, PA 15209 Ph: 1-888-GET-POOL. Join us on our Social Media channels: like us onFacebook, follow us onGoogle+,Instagram,PinterestandTwitter, or visit us onYouTube. This allows them to catch and hold onto fine dirt and sand. As water continuously flows through the filter, the contaminants trapped between the sand begin to build up eventually restricting the flow of water, increasing internal pressure and reducing the filter's efficiency. Why You Should Only Work With A Qualified Professional. In a much more compact body, the Jandy Pro Series CS Filter line utilizes single element cartridges designed to provide the same great water filtration as the Zodiac Large Tank Filter series. I am very pleased with the hot tub and I highly recommend Pete Alewine Pools for both their expertise and their first-rate customer service. This pool was installed by Petes team in 2012 and we have always used the services from his locations. But we still didn't have enough well water to fill our pool. They built our pool and spa! He installed the LARGE filters, balanced and sterilized the water, and walked us through the controls from pumps to the LED lights and Wifi sound system.
I highly recommend them. The media that it uses to do that job (sand, cartridges, etc. 2-in-1 Backwash Valve with NeverLube Technology. Ensure your backyard pool water is clean with the Summer Waves SkimmerPlus Pool Pump Replacement with 4-Pack Spa Filter Cartridge. Thank you so very much for helping me. Both the initial filter purchase, and the cartridge elements themselves, are more expensive. There was a coordination error on my end but once Service Manager Ben understood the problem he sent Nick back quickly with the right parts. I recommended them. We can even control the pool via our phones!! Pre Filter your water before it reaches the pump and filter system. They showed up when they said they'd be there (a rare occurrence in Lexington), and did excellent work. Maintenance is my #1 priority on the next spa I buy and Pete Alewine proved they have the very best service in the CSRA. Made of ABS with UV treatment. Advantages: Filters contaminants as small as 10 microns, no backwashing; less water waste, performs well at low speeds, such as with variable-speed pool pumps, cartridge inserts are inexpensive to replace, mid-cost filter Disadvantages: Requires slightly more manual work than sand pool filters, cartridge needs to be replaced every 2 to 3 years, deep cleaning required 1 to 2 times per year. This field is for validation purposes and should be left unchanged. And all the crew at Pete Alewine's Pool and Spa!
I love our pool and the process was seamless! This unit fits a standard skimmer cut out on your swimming pool.
You are hereby informed that you may exercise your right to submit complaints to the competent supervisory authority, namely, in the case of Spain, the Spanish Data Protection Agency at www.agpd.es. This filter pump attaches to the sidewalls of your framed pool and features easy maintenance and prevents tripping over hoses and pumps that would normally be on the ground. Use of this site is subject to certain Terms Of Use.
She recommended bromine because our pool was unusual, being an indoor pool and not being exposed to the sun's UV rays.As many customers do, I initially decided to go with what was familiar. 3 models available and 2 sizes each (16m3 and 20m3 ): concrete, prefabricated and panel pools. skimmer weir into The answer to that question comes down to what is important to you. We hear this question all the time.
Thank you for your service. I contacted Marquis Spas in California and they referred me to Pete Alewine Pool & Spa. Rather than using sand as a filtering agent, cartridge filters contain a pleated polyester filter. Y'all are one in a million! If there is an images appearing on this website that belongs to you and do not wish for it to appear of this site, please e-mail with a link to said image and it will be promptly removed. Diatomaceous earth is a natural, eco-friendly water polisher.
Very helpful staff with great quality pool products. We had an old tired pool and spa, waterline tiles cracked and in disrepair, concrete cracked and in disrepair and plaster cracked and in disrepair. Privacy Policy. Our line of inline cartridge filters are just the right match for all your pool filtering needs! However, with proper maintenance, a sand filter will continue to keep your pool clear and clean. My wife can just step into the pool which comes up 19.5" above the floor.This provided considerable maintenance access below deck. document.getElementById( "ak_js_1" ).setAttribute( "value", ( new Date() ).getTime() ); 4470 Washington Rd., Evans, GA 30809Phone: 706-863-1207, Lexington / Columbia5541 Sunset Blvd., Lexington, SC 29072Phone: 803-373-2238. We are getting a little older and hope this swim spa will add a few more years onto our once sedentary lifestyle. Knowing when to backwash a sand filter is easy.
We had water delivered, and this time, I listened to Pam. I work here, so I may be biased. Capture up to 80% of all dirt and organic matter.
This pump skimmer set has everything you need for installation, including hoses and hose clamps. The pool water filters through the sand, which catches debris and small particulates, and sends clean water back into the pool. Advantages: Low upfront cost, easy maintenance, sand lasts 5 to 7 years before needing to be changed, filtration efficiency can be boosted with additives or alternative media Disadvantages: 20-micron filtration is the least effective of the three types and backwashing is viewed by some as not environmentally friendly due to water waste. Wed would love the opportunity to earn your business! Similar to sand filters, a pressure gauge on the tank lets you know when it's time to backwash. Little did I know the manufacturer had no designated maintenance company in the CSRA. Pool filters are classified by the size of contaminants they can collect. Available in 6 Sizes HydroMax DE Filters are designed and engineered from the inside out. And balanced only occasionally with some pH Plus (sodium carbonate).It's so much easier with bromine!! I am well out of their service area, but I can't express enough how grateful I am that they took the time to make sure I got my spa repaired. They are staffed with hard working professionals who are also friendly and go out of their way to see that all things are running smoothly. This site uses its own and third-party cookies. We needed to have city water delivered via tanker. There's nothing more reliable pool builders than Pete Alewine Pool & Spa. Also a Great Job to (Forgot his name, sorry!!) Very pleased. I highly recommend. Its job is to catch debris, so as to limit the particles floating out in the pool.
document.getElementById("copyright_year").innerHTML = new Date().getFullYear(); The Colossus Skimmer System Includes: Extra-Deep Sifter Basket 2X Deeper, Above Ground Kit Includes 5 lbs Ph Plus 5 Lbs Alkalinity
These cookies are necessary to ensure proper navigation. Display ads that are relevant and engaging to you, as well as valuable to publishers ads such third parties. Do you have any Pool Service or Maintenance related questions that you need answered?
The skimmer drains the water and retains any debris. Water is introduced through the filter, runs through the material, and sends clear water back into the pool. The Jandy Pro Series CV Filter design takes advantage of the filters total surface area, providing the clearest possible water and extending cleaning cycles.
pool canopy ground above shade pools frame metal fits round summer accessories brandsonsale parts escapes oval summerbackyard After less than an hour Nick got my hot tub working again, (and got me out of the virtual dog house with the family).
I reached out to Pete Alewine and they immediately sent out a repair representative. John took the time to research my part number and tell me where I could buy a new pump. Be aware, some locations may have regulations that specify how to legally dispose of used DE. The water is then filtered by the integrated cartridge of 15 microns that delivers unbeatable filtration quality. Once the water is clean, it is sucked by the pump and sent back to the pool. Contracted with Pete to redo the concrete, tile and plaster and we could not be happier with their work ! Considering a single strand of human hair measures just 50 microns and bacteria can be as small as 2 microns, having a pool filter that can filter out the smallest contaminants from your pool water is essential to its clarity. I tried several local companies in the Western North Carolina area including the dealer which originally sold the spa. The Jandy Pro Series Backwash Valve features a straight-through, full-flow port design that optimizes flow and hydraulic efficiency. This place was very helpful in opening my pool up and maintaining it. People working there are smart and quite friendly. Prices, promotions, styles and availability may vary by store & online. !Now the spa edge is normally 56" high and folks use a stair or raised deck to access it. We knew exactly what was happening and they always answered any of our questions. Please call us at: 1-800-HOME-DEPOT (1-800-466-3337), Please enter in your email address in the following format: you@domain.com. Target does not represent or warrant that this information is accurate or complete. Sand filters are less expensive initially than their cartridge counterparts, are easy to maintain, and only require filter media changes every 5-7 years (depending on usage). Nautical Reef Above Ground Swimming Pool Liner, Black Diamond 525 Quad Cartridge Filter Tank For In Ground Swimming Pools, The Colossus Complete Skimmer System for Above Ground Swimming Pools, Opening Pool Chemical Kit for Above and In Ground Swimming Pools, Opening Pool Chemical Kit for In Ground Swimming Pools, 8lb Jumbo 3" Slow Tab Swimming Pool Chlorine Trichloro, Green Out Premium Pool Shock 1 lb Bags Fast Acting Formula, Hayward EC40 DE Filter with Blue Torrent 1 Pump, HydroMax 85 Auto-Regen DE Filter System - Tank Only, Perlite Diatomaceous Earth Alternative for DE Pool Filter Systems. Two-in-one skimmer and filter solution : Apple is not a participant or sponsor of this promotion. Incorporate gate, regulator lid height, skimmer basket and 2 cartridge filters. This website uses Google Analytics to collect anonymous information such as the number of visitors to the site, and the most popular pages. My experiences with Pete Alewine Pools and Spas have always been positive from the first time they came out to my home for Pool School. As a new homeowner who never previously had a pool, this was very informative. 2022 Zodiac Pool Systems LLC - All rights reserved. Drop in the Best When You Replace the Rest. Apple and the Apple logo are trademarks of Apple Inc., registered in the U.S. and other countries. We can have a nice peaceful swim or turn on the whitewater rapids for my grandkids, come summer or winter.Thank you Pam, Donnie, Nick, Ryan, and Jeremy! Francesc Maci, 60, planta 20, 08208 Sabadell (Barcelona) or an email to dataprivacy@fluidra.com, with the subject line Proteccin de Datos in both cases and a copy of a valid ID document.Should you wish to contact our DPO to submit any query or question, you may send an email to dataprivacy@fluidra.com or a letter to the address provided with the subject line "DPO". If the item details above arent accurate or complete, we want to know about it. All complete with pipe connectors, stainless steel clamps and all connection hoses. This pool cleaning filter pump features a pump flow rate of 1,500 gallons per hour. Further cleaning of the grids may be necessary each year to help your pool filter operate more efficiently and last longer. There were big balance swings, excessive solids (remember that well water), and ever rising chlorine stabilizer!I had to drain the pool and restart. progrid hayward Standard sand used in sand pool filters are capable of filtering contaminants that measure 20 microns and larger. This website uses cookies so that we can provide you with the best user experience possible. will test your water for free and advise you on the chemicals needed. when your cartridge gets dirty, just remove it from the filter unit, spray some filter cleaner on the cartridge, let it sit for 10 or 15 min and then wash it off with clean water and reinsert the cartridge into your filter unit. I hired them to upgrade my pool pump, switch to a salt water system, new filter, etc. All messages may be adapted and customized depending on users' interests, whether on the basis of products and services requested, or on the bases of the information we are able to infer or obtain from your browsing habits and your interest in certain contents and your reaction to our messages, amongst others. Highly professional and their customer service goes above and beyond. Ty! Pete and Toni are amazing people with a matching work ethic. Advantages: Highest degree of water clarity, filters contaminants as small as 2 microns, DE powder can be added through the pool skimmer, no caustic chemicals are required for cleaning Disadvantages: Highest cost filter, requires more maintenance, grid needs to be replaced every 2 to 3 years, backwashing wastes water and may be restricted by location (check with your pool pro to find out), DE powder can be harmful if inhaled (Wear a mask!). Less chemicals, less fussing, and less cost!! 2020 Pete Alewine Pool & Spa. However, the cartridge material itself filters out smaller particles than their sand counterparts. They were very professional, knowledgeable and friendly. Very polite and friendly. While you only need to replace the sand in your pool filter every 5 to 7 years, occasionally you will need to backwash the filter to clear out all the built-up debris. Nick was able to troubleshoot the exact nature of the problem in less than 30 minutes. Every cartridge only needs to be replaced every 2 weeks, giving you the time to enjoy a refreshing summer all season long. However, DE filters are more expensive and require the most maintenance of the three pool filter options. Thanks!!
Available in four sizes, these filters are designed for easy installation and replacement of existing residential filters. We just had our pool liner replaced and Don and his crew did a great job!
Aqua-line inline cartridge filters provide your pool with crystal clear water and can accommodate all size pool depending on unit. Diatomaceous earth (DE) filters are capable of filtering particles as small as 2 to 3 microns, providing the cleanest, clearest water of all three types of pool filters. Get clear, clean water with our durable Side-Mount Sand Filters.
If you have a specific question about this item, you may consult the item's label, contact the manufacturer directly or call Target Guest Services at 1-800-591-3869. I only hope I can remember the name of who did which assist!My wife and I first met many years ago at a local neighborhood pool and wished to have one in our retirement. We're rural, have limited well water available, and had a number of other hurdles we had to overcome to get our dream to come true.Due to limited water availability, numerous trees, and critters on the property (especially snakes), and winter temperatures, we decided to have an indoor pool installed. It was amazing! Economical Alternative to Provide Basic Backwash Functions. Thank to Ben at the Evans location for getting us setup as well! When the filter pump is running, water (and particulates) are pulled into the skimmers and/or drains, through the piping, into the pump, then into the filter, through the filter media, and then jettisoned back into the pool. All Rights Reserved. Copyright 2022 Swimming Pool Discounters. Sign up for regular updates and to get the Jandy Drop-In Replacement Guide for model comparisons, dimensions, and more.
That would allow us to prevent animal access, control contamination from leaves, rain, ground water, temperature variation and evaporation.We purchased the 14' x 7' ATV Sport with three pumps and full option package. Still have a few things to finalize in the next day or so after the pool fills up, but I'm confident it should be smooth sailing with these 2 on site. As pool water is pumped through the filtration system, it's pushed through a filter tank filled with sand where contaminants and debris are caught on the spiky edges of each sand particle. It was only until contacting this company and getting great advice,the pool cleaned up to a pretty light blue color after two treatments . A regular hose would take forever, possibly days. We shocked with borate, sanitized with the bromine and oxidizer. Make sure you keep your pool safe and sparkling clean all season long with the Summer Waves SkimmerPlus Pool Pump Replacement with 4-Pack Spa Filter Cartridge. We do not send general messages unless they are segmented using the aforementioned procedure, as we consider that it is both in the best interests of FLUIDRA and the user to send or receive information that is relevant, and because not segmenting it would not alter the number of messages sent, but rather just their content. Instead of adding the DE powder to the grids, you'll get better results by adding it through your pool's skimmer. Great guys!! I like this store. Need Help? This is usually a job that takes less than ten minutes, does not require a service call, and does not require taking the filter apart.
Are you in need of a sand change or a filter cartridge clean? Ive been working on cleaning my mothers pool for 3 months and did not get anywhere , it was still a deep green color. Please enable Strictly Necessary Cookies first so that we can save your preferences! Unlike a sand filter that can be backwashed, to clean a cartridge pool filter you simply need to remove the cartridge and spray it down with a hose until the water runs clear. DE pool filter tanks contain several grids coated with diatomaceous earth. We shocked and chlorinated, balanced and basically fought that water for a year. Find out more about our Service Department today by clicking here.
I made the mistake of buying a spa at the Civic Center during a sale. Over time, as the filter collects debris, you'll need to remove the pleated cartridge from within the tank to clean it. They also will load pool salt in your vehicle for you :)They also replaced my pool liner and did a really good job. I never experienced this kind of high quality work before. I called and talked to John. "But, with our water being unchlorinated and not exposed to the sun operating the pool, testing, balancing, and cleaning were unusually complicated. Joey helped me get squared away and was there through the entire install.
Thank You Pete Alewine! Every filter does the same thing. - Sending you the newsletter, which at all times shall be customized and adapted to your interests. Pursuant to the regulations in force on personal data protection, you are hereby informed that your personal data shall be processed by FLUIDRA S.A. (hereinafter FLUIDRA), located at Avda. Easy to install to your skimmer wall cut out, all sized for standard hayward hole opennings. His Customer Service and personal touches went above and beyond. Due to mobility limitations, we had to install the swim spa partially into the elevated floor for handicapped accessibility. The Colossus Skimmer System Includes: Extra-Deep Sifter Basket 2X Deeper SYSTEM INCLUDES: Complete Skimmer Standard Basket Vacuum Adapter Complete Return Fitting Hardware Gaskets Easy AquaPerl Direct Replacement for Diatomaceous Earth D.E AquaPerl Perlite Filter Powder is a new, lightweight, direct replacement for diatomaceous earth media. A pressure gauge on the sand filter alerts you when internal pressure increases and it's time to backwash the filter.
Appreciate that they have found cheaper alternative solutions when I came in asking for more expensive ones and have saved me $100s by giving me free advice to try before buying new products from them. Pool filters are made from various materials that can filter out these micro contaminants, choosing which one is the best for your pool comes down to price, pool size, required maintenance and overall cost of clarity. Skim filters are easy to operate . On occasion, manufacturers may modify their items and update their labels. Before the sale she did educate us on the various options for sanitizing our pool and balancing it. They will be hired to do the next one. They have answered the many questions I had with patience. Including staying late 15 minutes on a Friday afternoon for me to get some chemicals!!
17.5 L skimmer with cartridge system integrated. 3 Jumbo Tablets Green Out Shock- 1 lb Bags Strongest shock on the market Built in algaecide For super-chlorinating pool water 7 day chlorine residual pH Neutral 5 year shelf life Available in Hayward EC40 DE Filter Perflex Extended-Cycle diatomaceous earth (DE) filters provide crystal clear, sparkling water at an economical price. App Store is a service mark of Apple Inc. Google Play is trademark of Google, Inc. All other trademarks referenced herein are the property of their respective owners. ), is really the only difference. Pete Alewine sells and services two types of pool filters: sand filters and cartridge filters. The only pool company that would come out and look at issues with pool. All Rights Reserved. We are now enjoying our pool year round! I am so glad I chose Pete Alwine. He did this without ever making me feel pressured to purchase. These replacement filter cartridges filter out debris, dirt, and other contaminants thanks to ultra-fine, heavy-duty paper with more pleats than your average pool filter cartridge. Products shown as available are normally stocked but inventory levels cannot be guaranteed, For screen reader problems with this website, please call 1-800-430-3376 or text 38698 (standard carrier rates apply to texts), It's easy to overlook, but even your vacuum needs a good cleaning now and then, Happy Tab - Holds TWO 3 in. This means that every time you visit this website you will need to enable or disable cookies again. Country*COUNTRY*AUSTRALIAAUSTRIABELGIUMBRAZILBULGARIACANADACHILECHINACOLOMBIACROATIACYPRUSCZECH REPUBLICDENMARKEGYPTFRANCEGERMANYGREECEHONG KONGHUNGARYINDIAINDONESIAITALYKAZAHSTANMALAYSIAMEXICOMONTENEGROMOROCCONETHERLANDSNEW ZEALANDPOLANDPORTUGALROMANIARUSSIASERBIASINGAPORESOUTH AFRICASPAINSWEEDENSWITZERLANDTHAILANDTUNISIATURKEYUAEUNITED KINGDOMUSAVIETNAMOTHER COUNTRIES, Subject *Extra product informationComplete catalog.
That is the job of the chemicals circulated through the pool. As they say, "There's an App! The measurement used is known as micrometer (micron for short), which is just one millionth of a meter. Awesome people and great and honest service. We had a miscommunication with pool service and when I brought it to their attention, they resolved the issue immediately. I just wanted to give a shout out to Pete Alewine's Pool and Spa (PAP&S) with particular attention to their crew. The filter is one part of the circulatory system of the pool. Your pool's filter has an important job - to keep your pool clean. Multi-port Valves are constructed of molded ABS material with durable plastic handles. I needed a new pump for my plug-n-play Marquis spa. Give us a call Monday through Saturday. As I was not the original purchaser they were unwilling to help. Would highly recommend them and would give more stars if possible. 2017 Expertos en Piscinas y Spas AstralPool. We now have an 2" Camlock inlet for high speed filling and a separate outlet down stream for draining, all controlled by the Jandy Valve located under the house, with flood vents just in case.Nick, another spa technician came out and educated us on pool operation and initial setup. We recommend that you do not rely solely on the information presented. Kelvin was great and Knowledgeable about helping me with a Hot Tub I inherited. Chlorine Tabs.
Very nice people, there helped me with everything I needed. (Only thing was I wish they had told me to go pick up the bigger rocks on the ground before installing the new liner. The diatoms act just like a sponge water can pass through, but microscopic impurities like dirt, algae, and some forms of bacteria can't. Units will give you years of trouble free cleaning. All sand filters have an installed pressure gauge. filter sand ground above sandman wave system inch pump pools pool swimming filters gallon 1hp hp Island Recreational. All Rights Reserved. To this regard, any users who do not wish to be segmented should refrain from signing up for the newsletter.Your data shall not be assigned, sold, leased or in any other way whatsoever made available to third parties. Glad this place opened up close. All Aqua-line filters come with a new filter cartridge. 2000-2022 Home Depot. They got it done earlier than expected and the best thing about it was it was 100% stress free for me! They are available in two models: top and side mount. He helped me design a system that allowed us to install 2" PVC pipes with a 3-way Jandy Valve from the high speed drain. He did a great job and didnt have to spend all day on it. 2141 Babcock Blvd Pittsburgh, PA 15209 Ph: 1-888-GET-POOL. Join us on our Social Media channels: like us onFacebook, follow us onGoogle+,Instagram,PinterestandTwitter, or visit us onYouTube. This allows them to catch and hold onto fine dirt and sand. As water continuously flows through the filter, the contaminants trapped between the sand begin to build up eventually restricting the flow of water, increasing internal pressure and reducing the filter's efficiency. Why You Should Only Work With A Qualified Professional. In a much more compact body, the Jandy Pro Series CS Filter line utilizes single element cartridges designed to provide the same great water filtration as the Zodiac Large Tank Filter series. I am very pleased with the hot tub and I highly recommend Pete Alewine Pools for both their expertise and their first-rate customer service. This pool was installed by Petes team in 2012 and we have always used the services from his locations. But we still didn't have enough well water to fill our pool. They built our pool and spa! He installed the LARGE filters, balanced and sterilized the water, and walked us through the controls from pumps to the LED lights and Wifi sound system.
I highly recommend them. The media that it uses to do that job (sand, cartridges, etc. 2-in-1 Backwash Valve with NeverLube Technology. Ensure your backyard pool water is clean with the Summer Waves SkimmerPlus Pool Pump Replacement with 4-Pack Spa Filter Cartridge. Thank you so very much for helping me. Both the initial filter purchase, and the cartridge elements themselves, are more expensive. There was a coordination error on my end but once Service Manager Ben understood the problem he sent Nick back quickly with the right parts. I recommended them. We can even control the pool via our phones!! Pre Filter your water before it reaches the pump and filter system. They showed up when they said they'd be there (a rare occurrence in Lexington), and did excellent work. Maintenance is my #1 priority on the next spa I buy and Pete Alewine proved they have the very best service in the CSRA. Made of ABS with UV treatment. Advantages: Filters contaminants as small as 10 microns, no backwashing; less water waste, performs well at low speeds, such as with variable-speed pool pumps, cartridge inserts are inexpensive to replace, mid-cost filter Disadvantages: Requires slightly more manual work than sand pool filters, cartridge needs to be replaced every 2 to 3 years, deep cleaning required 1 to 2 times per year. This field is for validation purposes and should be left unchanged. And all the crew at Pete Alewine's Pool and Spa!
I love our pool and the process was seamless! This unit fits a standard skimmer cut out on your swimming pool.
You are hereby informed that you may exercise your right to submit complaints to the competent supervisory authority, namely, in the case of Spain, the Spanish Data Protection Agency at www.agpd.es. This filter pump attaches to the sidewalls of your framed pool and features easy maintenance and prevents tripping over hoses and pumps that would normally be on the ground. Use of this site is subject to certain Terms Of Use.
She recommended bromine because our pool was unusual, being an indoor pool and not being exposed to the sun's UV rays.As many customers do, I initially decided to go with what was familiar. 3 models available and 2 sizes each (16m3 and 20m3 ): concrete, prefabricated and panel pools. skimmer weir into The answer to that question comes down to what is important to you. We hear this question all the time.
Thank you for your service. I contacted Marquis Spas in California and they referred me to Pete Alewine Pool & Spa. Rather than using sand as a filtering agent, cartridge filters contain a pleated polyester filter. Y'all are one in a million! If there is an images appearing on this website that belongs to you and do not wish for it to appear of this site, please e-mail with a link to said image and it will be promptly removed. Diatomaceous earth is a natural, eco-friendly water polisher.
Very helpful staff with great quality pool products. We had an old tired pool and spa, waterline tiles cracked and in disrepair, concrete cracked and in disrepair and plaster cracked and in disrepair. Privacy Policy. Our line of inline cartridge filters are just the right match for all your pool filtering needs! However, with proper maintenance, a sand filter will continue to keep your pool clear and clean. My wife can just step into the pool which comes up 19.5" above the floor.This provided considerable maintenance access below deck. document.getElementById( "ak_js_1" ).setAttribute( "value", ( new Date() ).getTime() ); 4470 Washington Rd., Evans, GA 30809Phone: 706-863-1207, Lexington / Columbia5541 Sunset Blvd., Lexington, SC 29072Phone: 803-373-2238. We are getting a little older and hope this swim spa will add a few more years onto our once sedentary lifestyle. Knowing when to backwash a sand filter is easy.
We had water delivered, and this time, I listened to Pam. I work here, so I may be biased. Capture up to 80% of all dirt and organic matter.
This pump skimmer set has everything you need for installation, including hoses and hose clamps. The pool water filters through the sand, which catches debris and small particulates, and sends clean water back into the pool. Advantages: Low upfront cost, easy maintenance, sand lasts 5 to 7 years before needing to be changed, filtration efficiency can be boosted with additives or alternative media Disadvantages: 20-micron filtration is the least effective of the three types and backwashing is viewed by some as not environmentally friendly due to water waste. Wed would love the opportunity to earn your business! Similar to sand filters, a pressure gauge on the tank lets you know when it's time to backwash. Little did I know the manufacturer had no designated maintenance company in the CSRA. Pool filters are classified by the size of contaminants they can collect. Available in 6 Sizes HydroMax DE Filters are designed and engineered from the inside out. And balanced only occasionally with some pH Plus (sodium carbonate).It's so much easier with bromine!! I am well out of their service area, but I can't express enough how grateful I am that they took the time to make sure I got my spa repaired. They are staffed with hard working professionals who are also friendly and go out of their way to see that all things are running smoothly. This site uses its own and third-party cookies. We needed to have city water delivered via tanker. There's nothing more reliable pool builders than Pete Alewine Pool & Spa. Also a Great Job to (Forgot his name, sorry!!) Very pleased. I highly recommend. Its job is to catch debris, so as to limit the particles floating out in the pool.
document.getElementById("copyright_year").innerHTML = new Date().getFullYear(); The Colossus Skimmer System Includes: Extra-Deep Sifter Basket 2X Deeper, Above Ground Kit Includes 5 lbs Ph Plus 5 Lbs Alkalinity
These cookies are necessary to ensure proper navigation. Display ads that are relevant and engaging to you, as well as valuable to publishers ads such third parties. Do you have any Pool Service or Maintenance related questions that you need answered?
The skimmer drains the water and retains any debris. Water is introduced through the filter, runs through the material, and sends clear water back into the pool. The Jandy Pro Series CV Filter design takes advantage of the filters total surface area, providing the clearest possible water and extending cleaning cycles.
pool canopy ground above shade pools frame metal fits round summer accessories brandsonsale parts escapes oval summerbackyard After less than an hour Nick got my hot tub working again, (and got me out of the virtual dog house with the family).
I reached out to Pete Alewine and they immediately sent out a repair representative. John took the time to research my part number and tell me where I could buy a new pump. Be aware, some locations may have regulations that specify how to legally dispose of used DE. The water is then filtered by the integrated cartridge of 15 microns that delivers unbeatable filtration quality. Once the water is clean, it is sucked by the pump and sent back to the pool. Contracted with Pete to redo the concrete, tile and plaster and we could not be happier with their work ! Considering a single strand of human hair measures just 50 microns and bacteria can be as small as 2 microns, having a pool filter that can filter out the smallest contaminants from your pool water is essential to its clarity. I tried several local companies in the Western North Carolina area including the dealer which originally sold the spa. The Jandy Pro Series Backwash Valve features a straight-through, full-flow port design that optimizes flow and hydraulic efficiency. This place was very helpful in opening my pool up and maintaining it. People working there are smart and quite friendly. Prices, promotions, styles and availability may vary by store & online. !Now the spa edge is normally 56" high and folks use a stair or raised deck to access it. We knew exactly what was happening and they always answered any of our questions. Please call us at: 1-800-HOME-DEPOT (1-800-466-3337), Please enter in your email address in the following format: you@domain.com. Target does not represent or warrant that this information is accurate or complete. Sand filters are less expensive initially than their cartridge counterparts, are easy to maintain, and only require filter media changes every 5-7 years (depending on usage). Nautical Reef Above Ground Swimming Pool Liner, Black Diamond 525 Quad Cartridge Filter Tank For In Ground Swimming Pools, The Colossus Complete Skimmer System for Above Ground Swimming Pools, Opening Pool Chemical Kit for Above and In Ground Swimming Pools, Opening Pool Chemical Kit for In Ground Swimming Pools, 8lb Jumbo 3" Slow Tab Swimming Pool Chlorine Trichloro, Green Out Premium Pool Shock 1 lb Bags Fast Acting Formula, Hayward EC40 DE Filter with Blue Torrent 1 Pump, HydroMax 85 Auto-Regen DE Filter System - Tank Only, Perlite Diatomaceous Earth Alternative for DE Pool Filter Systems. Two-in-one skimmer and filter solution : Apple is not a participant or sponsor of this promotion. Incorporate gate, regulator lid height, skimmer basket and 2 cartridge filters. This website uses Google Analytics to collect anonymous information such as the number of visitors to the site, and the most popular pages. My experiences with Pete Alewine Pools and Spas have always been positive from the first time they came out to my home for Pool School. As a new homeowner who never previously had a pool, this was very informative. 2022 Zodiac Pool Systems LLC - All rights reserved. Drop in the Best When You Replace the Rest. Apple and the Apple logo are trademarks of Apple Inc., registered in the U.S. and other countries. We can have a nice peaceful swim or turn on the whitewater rapids for my grandkids, come summer or winter.Thank you Pam, Donnie, Nick, Ryan, and Jeremy! Francesc Maci, 60, planta 20, 08208 Sabadell (Barcelona) or an email to dataprivacy@fluidra.com, with the subject line Proteccin de Datos in both cases and a copy of a valid ID document.Should you wish to contact our DPO to submit any query or question, you may send an email to dataprivacy@fluidra.com or a letter to the address provided with the subject line "DPO". If the item details above arent accurate or complete, we want to know about it. All complete with pipe connectors, stainless steel clamps and all connection hoses. This pool cleaning filter pump features a pump flow rate of 1,500 gallons per hour. Further cleaning of the grids may be necessary each year to help your pool filter operate more efficiently and last longer. There were big balance swings, excessive solids (remember that well water), and ever rising chlorine stabilizer!I had to drain the pool and restart. progrid hayward Standard sand used in sand pool filters are capable of filtering contaminants that measure 20 microns and larger. This website uses cookies so that we can provide you with the best user experience possible. will test your water for free and advise you on the chemicals needed. when your cartridge gets dirty, just remove it from the filter unit, spray some filter cleaner on the cartridge, let it sit for 10 or 15 min and then wash it off with clean water and reinsert the cartridge into your filter unit. I hired them to upgrade my pool pump, switch to a salt water system, new filter, etc. All messages may be adapted and customized depending on users' interests, whether on the basis of products and services requested, or on the bases of the information we are able to infer or obtain from your browsing habits and your interest in certain contents and your reaction to our messages, amongst others. Highly professional and their customer service goes above and beyond. Ty! Pete and Toni are amazing people with a matching work ethic. Advantages: Highest degree of water clarity, filters contaminants as small as 2 microns, DE powder can be added through the pool skimmer, no caustic chemicals are required for cleaning Disadvantages: Highest cost filter, requires more maintenance, grid needs to be replaced every 2 to 3 years, backwashing wastes water and may be restricted by location (check with your pool pro to find out), DE powder can be harmful if inhaled (Wear a mask!). Less chemicals, less fussing, and less cost!! 2020 Pete Alewine Pool & Spa. However, the cartridge material itself filters out smaller particles than their sand counterparts. They were very professional, knowledgeable and friendly. Very polite and friendly. While you only need to replace the sand in your pool filter every 5 to 7 years, occasionally you will need to backwash the filter to clear out all the built-up debris. Nick was able to troubleshoot the exact nature of the problem in less than 30 minutes. Every cartridge only needs to be replaced every 2 weeks, giving you the time to enjoy a refreshing summer all season long. However, DE filters are more expensive and require the most maintenance of the three pool filter options. Thanks!!
Available in four sizes, these filters are designed for easy installation and replacement of existing residential filters. We just had our pool liner replaced and Don and his crew did a great job!
Aqua-line inline cartridge filters provide your pool with crystal clear water and can accommodate all size pool depending on unit. Diatomaceous earth (DE) filters are capable of filtering particles as small as 2 to 3 microns, providing the cleanest, clearest water of all three types of pool filters. Get clear, clean water with our durable Side-Mount Sand Filters.
If you have a specific question about this item, you may consult the item's label, contact the manufacturer directly or call Target Guest Services at 1-800-591-3869. I only hope I can remember the name of who did which assist!My wife and I first met many years ago at a local neighborhood pool and wished to have one in our retirement. We're rural, have limited well water available, and had a number of other hurdles we had to overcome to get our dream to come true.Due to limited water availability, numerous trees, and critters on the property (especially snakes), and winter temperatures, we decided to have an indoor pool installed. It was amazing! Economical Alternative to Provide Basic Backwash Functions. Thank to Ben at the Evans location for getting us setup as well! When the filter pump is running, water (and particulates) are pulled into the skimmers and/or drains, through the piping, into the pump, then into the filter, through the filter media, and then jettisoned back into the pool. All Rights Reserved. Copyright 2022 Swimming Pool Discounters. Sign up for regular updates and to get the Jandy Drop-In Replacement Guide for model comparisons, dimensions, and more.
That would allow us to prevent animal access, control contamination from leaves, rain, ground water, temperature variation and evaporation.We purchased the 14' x 7' ATV Sport with three pumps and full option package. Still have a few things to finalize in the next day or so after the pool fills up, but I'm confident it should be smooth sailing with these 2 on site. As pool water is pumped through the filtration system, it's pushed through a filter tank filled with sand where contaminants and debris are caught on the spiky edges of each sand particle. It was only until contacting this company and getting great advice,the pool cleaned up to a pretty light blue color after two treatments . A regular hose would take forever, possibly days. We shocked with borate, sanitized with the bromine and oxidizer. Make sure you keep your pool safe and sparkling clean all season long with the Summer Waves SkimmerPlus Pool Pump Replacement with 4-Pack Spa Filter Cartridge. We do not send general messages unless they are segmented using the aforementioned procedure, as we consider that it is both in the best interests of FLUIDRA and the user to send or receive information that is relevant, and because not segmenting it would not alter the number of messages sent, but rather just their content. Instead of adding the DE powder to the grids, you'll get better results by adding it through your pool's skimmer. Great guys!! I like this store. Need Help? This is usually a job that takes less than ten minutes, does not require a service call, and does not require taking the filter apart.
Are you in need of a sand change or a filter cartridge clean? Ive been working on cleaning my mothers pool for 3 months and did not get anywhere , it was still a deep green color. Please enable Strictly Necessary Cookies first so that we can save your preferences! Unlike a sand filter that can be backwashed, to clean a cartridge pool filter you simply need to remove the cartridge and spray it down with a hose until the water runs clear. DE pool filter tanks contain several grids coated with diatomaceous earth. We shocked and chlorinated, balanced and basically fought that water for a year. Find out more about our Service Department today by clicking here.
I made the mistake of buying a spa at the Civic Center during a sale. Over time, as the filter collects debris, you'll need to remove the pleated cartridge from within the tank to clean it. They also will load pool salt in your vehicle for you :)They also replaced my pool liner and did a really good job. I never experienced this kind of high quality work before. I called and talked to John. "But, with our water being unchlorinated and not exposed to the sun operating the pool, testing, balancing, and cleaning were unusually complicated. Joey helped me get squared away and was there through the entire install.
Thank You Pete Alewine! Every filter does the same thing. - Sending you the newsletter, which at all times shall be customized and adapted to your interests. Pursuant to the regulations in force on personal data protection, you are hereby informed that your personal data shall be processed by FLUIDRA S.A. (hereinafter FLUIDRA), located at Avda. Easy to install to your skimmer wall cut out, all sized for standard hayward hole opennings. His Customer Service and personal touches went above and beyond. Due to mobility limitations, we had to install the swim spa partially into the elevated floor for handicapped accessibility. The Colossus Skimmer System Includes: Extra-Deep Sifter Basket 2X Deeper SYSTEM INCLUDES: Complete Skimmer Standard Basket Vacuum Adapter Complete Return Fitting Hardware Gaskets Easy AquaPerl Direct Replacement for Diatomaceous Earth D.E AquaPerl Perlite Filter Powder is a new, lightweight, direct replacement for diatomaceous earth media. A pressure gauge on the sand filter alerts you when internal pressure increases and it's time to backwash the filter.